![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
![]() | Protein Carboxypeptidase B [53193] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75248] (2 PDB entries) |
![]() | Domain d1kwma1: 1kwm A:4-309 [73079] Other proteins in same PDB: d1kwma2, d1kwmb2 zymogen complexed with cit, zn |
PDB Entry: 1kwm (more details), 1.6 Å
SCOPe Domain Sequences for d1kwma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwma1 c.56.5.1 (A:4-309) Carboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]} atghsyekynkwetieawtqqvatenpalisrsvigttfegraiyllkvgkagqnkpaif mdcgfharewispafcqwfvreavrtygreiqvtellnkldfyvlpvlnidgyiytwtks rfwrktrsthtgsscigtdpnrnfdagwceigasrnpcdetycgpaaeseketkaladfi rnklssikayltihsysqmmiypysyayklgennaelnalakatvkelaslhgtkytygp gattiypaaggsddwaydqgirysftfelrdtgrygfllpesqiratceetflaikyvas yvlehly
Timeline for d1kwma1: