Lineage for d1kwfa_ (1kwf A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284253Protein CelA cellulase [48214] (1 species)
  7. 284254Species Clostridium thermocellum [TaxId:1515] [48215] (3 PDB entries)
  8. 284255Domain d1kwfa_: 1kwf A: [73078]
    complexed with glc; mutant

Details for d1kwfa_

PDB Entry: 1kwf (more details), 0.94 Å

PDB Description: atomic resolution structure of an inverting glycosidase in complex with substrate

SCOP Domain Sequences for d1kwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum}
agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
vsqgmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
adedialalifadklwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
sdl

SCOP Domain Coordinates for d1kwfa_:

Click to download the PDB-style file with coordinates for d1kwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kwfa_: