Lineage for d1kwfa_ (1kwf A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155275Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 155276Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (4 families) (S)
  5. 155288Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 155289Protein CelA cellulase [48214] (1 species)
  7. 155290Species Clostridium thermocellum [TaxId:1515] [48215] (2 PDB entries)
  8. 155291Domain d1kwfa_: 1kwf A: [73078]

Details for d1kwfa_

PDB Entry: 1kwf (more details), 0.94 Å

PDB Description: atomic resolution structure of an inverting glycosidase in complex with substrate

SCOP Domain Sequences for d1kwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum}
agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
vsqgmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
adedialalifadklwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
sdl

SCOP Domain Coordinates for d1kwfa_:

Click to download the PDB-style file with coordinates for d1kwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kwfa_: