Lineage for d1kw4a_ (1kw4 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539306Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 539338Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (10 proteins)
  6. 539365Protein Polyhomeotic [74737] (1 species)
  7. 539366Species Drosophila melanogaster [TaxId:7227] [74738] (1 PDB entry)
  8. 539367Domain d1kw4a_: 1kw4 A: [73077]
    complexed with mse; mutant

Details for d1kw4a_

PDB Entry: 1kw4 (more details), 1.75 Å

PDB Description: polyhomeotic sam domain structure

SCOP Domain Sequences for d1kw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster}
drppisswsvddvsnfirelpgcqdyvddfiqqeidgqallrlkekhlvnamgmklgpal
kivakvesik

SCOP Domain Coordinates for d1kw4a_:

Click to download the PDB-style file with coordinates for d1kw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kw4a_: