SCOPe 2.06: Domain d1kw2b3: 1kw2 B:405-474

Lineage for d1kw2b3 (1kw2 B:405-474)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1kw2b3: 1kw2 B:405-474 [73076]

Details for d1kw2b3

PDB Entry: 1kw2, 2.15 Å

PDB Description: crystal structure of uncomplexed vitamin d-binding protein

PDB Compounds: (B:) Vitamin D-binding protein

SCOPe Domain Sequences for d1kw2b3:

Sequence; same for both SEQRES and ATOM records:

>d1kw2b3 a.126.1.1 (B:405-474) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
elcadysentfteykkklaerlkaklpdatpkelaklvnkrsdfasnccsinspplycds
eidaelknil

Timeline for d1kw2b3:

• d1kw2b3 first appeared in SCOP 1.61
  
• d1kw2b3 appears in SCOPe 2.05
  
• d1kw2b3 appears in SCOPe 2.07
  
• d1kw2b3 appears in the current release, SCOPe 2.08