Lineage for d1kw2a1 (1kw2 A:20-214)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748373Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1748677Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1748678Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1748682Domain d1kw2a1: 1kw2 A:20-214 [73071]

Details for d1kw2a1

PDB Entry: 1kw2 (more details), 2.15 Å

PDB Description: crystal structure of uncomplexed vitamin d-binding protein
PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1kw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw2a1 a.126.1.1 (A:20-214) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
grdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaega
dpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyvep
tndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcf
lkerlqlkhlslltt

SCOPe Domain Coordinates for d1kw2a1:

Click to download the PDB-style file with coordinates for d1kw2a1.
(The format of our PDB-style files is described here.)

Timeline for d1kw2a1: