Lineage for d1kw1b_ (1kw1 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172830Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 172831Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 172832Species Escherichia coli [TaxId:562] [75051] (2 PDB entries)
  8. 172836Domain d1kw1b_: 1kw1 B: [73070]

Details for d1kw1b_

PDB Entry: 1kw1 (more details), 2.2 Å

PDB Description: Crystal Structure of 3-Keto-L-Gulonate 6-Phosphate Decarboxylase with bound L-gulonate 6-phosphate

SCOP Domain Sequences for d1kw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw1b_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

SCOP Domain Coordinates for d1kw1b_:

Click to download the PDB-style file with coordinates for d1kw1b_.
(The format of our PDB-style files is described here.)

Timeline for d1kw1b_: