Lineage for d1kvza_ (1kvz A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635085Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1635086Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1635095Species Bullfrog (Rana catesbeiana), RNase4 [TaxId:8400] [75339] (1 PDB entry)
  8. 1635096Domain d1kvza_: 1kvz A: [73068]

Details for d1kvza_

PDB Entry: 1kvz (more details)

PDB Description: solution structure of cytotoxic rc-rnase4
PDB Compounds: (A:) RC-RNase4

SCOPe Domain Sequences for d1kvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvza_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase4 [TaxId: 8400]}
mqdwatfkkkhltdtwdvdcdnlmptslfdckdkntfiyslpgpvkalcrgvifsadvls
nsefylaecnvkprkpckyklkkssnricircehelpvhfagvgicp

SCOPe Domain Coordinates for d1kvza_:

Click to download the PDB-style file with coordinates for d1kvza_.
(The format of our PDB-style files is described here.)

Timeline for d1kvza_: