Lineage for d1kvza_ (1kvz A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188484Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 188485Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 188486Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 188487Protein Amphibian cytotoxic ribonuclease [54084] (3 species)
  7. 188490Species Bullfrog (Rana catesbeiana), RNase4 [TaxId:8400] [75339] (1 PDB entry)
  8. 188491Domain d1kvza_: 1kvz A: [73068]

Details for d1kvza_

PDB Entry: 1kvz (more details)

PDB Description: solution structure of cytotoxic rc-rnase4

SCOP Domain Sequences for d1kvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvza_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase4}
mqdwatfkkkhltdtwdvdcdnlmptslfdckdkntfiyslpgpvkalcrgvifsadvls
nsefylaecnvkprkpckyklkkssnricircehelpvhfagvgicp

SCOP Domain Coordinates for d1kvza_:

Click to download the PDB-style file with coordinates for d1kvza_.
(The format of our PDB-style files is described here.)

Timeline for d1kvza_: