Lineage for d1kvna_ (1kvn A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445654Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1445655Superfamily d.201.1: SRP19 [69695] (2 families) (S)
    automatically mapped to Pfam PF01922
  5. 1445656Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 1445657Protein SRP19 [69697] (3 species)
  7. 1445658Species Archaeoglobus fulgidus [TaxId:2234] [75416] (2 PDB entries)
  8. 1445660Domain d1kvna_: 1kvn A: [73066]

Details for d1kvna_

PDB Entry: 1kvn (more details)

PDB Description: solution structure of protein srp19 of the arhaeoglobus fulgidus signal recognition particle, 10 structures
PDB Compounds: (A:) srp19

SCOPe Domain Sequences for d1kvna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvna_ d.201.1.1 (A:) SRP19 {Archaeoglobus fulgidus [TaxId: 2234]}
mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww
eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk

SCOPe Domain Coordinates for d1kvna_:

Click to download the PDB-style file with coordinates for d1kvna_.
(The format of our PDB-style files is described here.)

Timeline for d1kvna_: