![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.201: SRP19 [69694] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.201.1: SRP19 [69695] (2 families) ![]() automatically mapped to Pfam PF01922 |
![]() | Family d.201.1.1: SRP19 [69696] (1 protein) |
![]() | Protein SRP19 [69697] (3 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [75416] (2 PDB entries) |
![]() | Domain d1kvna_: 1kvn A: [73066] |
PDB Entry: 1kvn (more details)
SCOPe Domain Sequences for d1kvna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kvna_ d.201.1.1 (A:) SRP19 {Archaeoglobus fulgidus [TaxId: 2234]} mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk
Timeline for d1kvna_: