Lineage for d1kvla_ (1kvl A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949301Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1949342Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)
  8. 1949383Domain d1kvla_: 1kvl A: [73062]
    complexed with cls, kcp, po4, thn; mutant

Details for d1kvla_

PDB Entry: 1kvl (more details), 1.53 Å

PDB Description: x-ray crystal structure of ampc s64g mutant beta-lactamase in complex with substrate and product forms of cephalothin
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1kvla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvla_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
gvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d1kvla_:

Click to download the PDB-style file with coordinates for d1kvla_.
(The format of our PDB-style files is described here.)

Timeline for d1kvla_: