Lineage for d1kvka2 (1kvk A:226-394)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412999Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 413021Family d.58.26.3: Mevalonate kinase [75450] (1 protein)
  6. 413022Protein Mevalonate kinase [75451] (2 species)
  7. 413026Species Rat (Rattus norvegicus) [TaxId:10116] [75453] (1 PDB entry)
  8. 413027Domain d1kvka2: 1kvk A:226-394 [73061]
    Other proteins in same PDB: d1kvka1
    complexed with atp, mg

Details for d1kvka2

PDB Entry: 1kvk (more details), 2.4 Å

PDB Description: the structure of binary complex between a mammalian mevalonate kinase and atp: insights into the reaction mechanism and human inherited disease

SCOP Domain Sequences for d1kvka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvka2 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus norvegicus)}
rlpalqilltntkvprstkalvagvrsrlikfpeimaplltsidaislecervlgemaaa
pvpeqylvleelmdmnqhhlnalgvghasldqlcqvtaahglhskltgaggggcgitllk
pglerakveaakqaltgcgfdcwetsigapgvsmhsatsiedpvrqalg

SCOP Domain Coordinates for d1kvka2:

Click to download the PDB-style file with coordinates for d1kvka2.
(The format of our PDB-style files is described here.)

Timeline for d1kvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kvka1