Lineage for d1kvka1 (1kvk A:1-225)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2537724Protein Mevalonate kinase [75353] (3 species)
  7. 2537733Species Norway rat (Rattus norvegicus) [TaxId:10116] [75355] (2 PDB entries)
  8. 2537735Domain d1kvka1: 1kvk A:1-225 [73060]
    Other proteins in same PDB: d1kvka2
    complexed with atp, mg

Details for d1kvka1

PDB Entry: 1kvk (more details), 2.4 Å

PDB Description: the structure of binary complex between a mammalian mevalonate kinase and atp: insights into the reaction mechanism and human inherited disease
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1kvka1:

Sequence, based on SEQRES records: (download)

>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlsevllvsapgkvilhgehavvhgkvalavalnlrtflvlrpqsngkvslnlpnvgikq
vwdvatlqlldtgfleqgdvpaptleqleklkkvaglprdcvgneglsllaflylylaic
rkqrtlpsldimvwselppgaglgssaaysvcvaaalltaceevtnplkdrgsigswpee
dlksinkwayegervihgnpsgvdnsvstwggalryqqgkmsslk

Sequence, based on observed residues (ATOM records): (download)

>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlsevllvsapgkvilhgehavvhgkvalavalnlrtflvlrpqsngkvslnlpnvgikq
vwdvatlqlldteklkkvaglprdcvgneglsllaflylylaicrkqrtlpsldimvwse
lppgaglgssaaysvcvaaalltaceevtnplkdrgsigswpeedlksinkwayegervi
hgnpsgvdnsvstwggalryqqgkmsslk

SCOPe Domain Coordinates for d1kvka1:

Click to download the PDB-style file with coordinates for d1kvka1.
(The format of our PDB-style files is described here.)

Timeline for d1kvka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kvka2