Lineage for d1kv9a2 (1kv9 A:1-560)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066614Protein Quinoprotein alcohol dehydrogenase, N-terminal domain [69326] (2 species)
    fused with the C-terminal cytochrome c domain
  7. 2066617Species Pseudomonas putida, hk5 [TaxId:303] [75015] (1 PDB entry)
  8. 2066618Domain d1kv9a2: 1kv9 A:1-560 [73057]
    Other proteins in same PDB: d1kv9a1
    complexed with acn, ca, epe, gol, hem, pqq

Details for d1kv9a2

PDB Entry: 1kv9 (more details), 1.9 Å

PDB Description: Structure at 1.9 A Resolution of a Quinohemoprotein Alcohol Dehydrogenase from Pseudomonas putida HK5
PDB Compounds: (A:) type II quinohemoprotein alcohol dehydrogenase

SCOPe Domain Sequences for d1kv9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}
agvdeaairateqaggewlshgrtyaeqrfsplkqidasnvrslglawymdldntrglea
tplfhdgviytsmswsrviavdaasgkelwrydpevakvkartsccdavnrgvalwgdkv
yvgtldgrlialdaktgkaiwsqqttdpakpysitgaprvvkgkviignggaeygvrgfv
saydadtgklawrfytvpgdpalpyehpelreaaktwqgdqywklggggtvwdsmaydpe
ldllyvgtgngspwnrevrspgggdnlylssilairpdtgklawhyqvtpgdswdftatq
qitlaelnidgkprkvlmqapkngffyvldrtngklisaekfgkvtwaekvdlatgrpve
apgvryekepivmwpspfgahnwhsmsfnpgtglvyipyqevpgvyrnegkdfvtrkafn
taagfadatdvpaavvsgallawdpvkqkaawkvpypthwnggtlstagnlvfqgtaagq
mhaysadkgealwqfeaqsgivaapmtfelagrqyvaimagwggvatltggesmnlpgmk
nrsrllvfaldgkaqlpppa

SCOPe Domain Coordinates for d1kv9a2:

Click to download the PDB-style file with coordinates for d1kv9a2.
(The format of our PDB-style files is described here.)

Timeline for d1kv9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kv9a1