Lineage for d1kv9a1 (1kv9 A:561-664)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 761098Family a.3.1.6: Quinoprotein alcohol dehydrogenase, C-terminal domain [68952] (1 protein)
  6. 761099Protein Quinoprotein alcohol dehydrogenase, C-terminal domain [68953] (2 species)
  7. 761102Species Pseudomonas putida, hk5 [TaxId:303] [74669] (1 PDB entry)
  8. 761103Domain d1kv9a1: 1kv9 A:561-664 [73056]
    Other proteins in same PDB: d1kv9a2
    complexed with acn, ca, epe, gol, hem, pqq

Details for d1kv9a1

PDB Entry: 1kv9 (more details), 1.9 Å

PDB Description: structure at 1.9 a resolution of a quinohemoprotein alcohol dehydrogenase from pseudomonas putida hk5
PDB Compounds: (A:) type II quinohemoprotein alcohol dehydrogenase

SCOP Domain Sequences for d1kv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv9a1 a.3.1.6 (A:561-664) Quinoprotein alcohol dehydrogenase, C-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}
papakvervpqpvtaapeqvqagkqlygqfcsvchgmgtisgglipdlrqssdatrehfq
qivlqgalkplgmpsfddslkpeeveqiklyvmsreyedymarh

SCOP Domain Coordinates for d1kv9a1:

Click to download the PDB-style file with coordinates for d1kv9a1.
(The format of our PDB-style files is described here.)

Timeline for d1kv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kv9a2