Lineage for d1kv5b_ (1kv5 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815516Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1815523Domain d1kv5b_: 1kv5 B: [73053]
    complexed with dtt, gol, pga, so4

Details for d1kv5b_

PDB Entry: 1kv5 (more details), 1.65 Å

PDB Description: structure of trypanosoma brucei brucei tim with the salt-bridge- forming residue arg191 mutated to ser
PDB Compounds: (B:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d1kv5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv5b_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalisswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d1kv5b_:

Click to download the PDB-style file with coordinates for d1kv5b_.
(The format of our PDB-style files is described here.)

Timeline for d1kv5b_: