SCOP 1.65: Domain d1kv3e2: 1kv3 E:469-585

Lineage for d1kv3e2 (1kv3 E:469-585)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (1 PDB entry)
   GDP-binding protein

8. Domain d1kv3e2: 1kv3 E:469-585 [73044]
   Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4

Details for d1kv3e2

PDB Entry: 1kv3, 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

SCOP Domain Sequences for d1kv3e2:

Sequence; same for both SEQRES and ATOM records:

>d1kv3e2 b.1.5.1 (E:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme}
eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky
llnltlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

Timeline for d1kv3e2:

• d1kv3e2 first appeared in SCOP 1.61
  
• d1kv3e2 appears in SCOP 1.63
  
• d1kv3e2 appears in SCOP 1.67
  
• d1kv3e2 appears in the current release, SCOPe 2.08