Lineage for d1kv3d3 (1kv3 D:586-687)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161380Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 161381Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 161382Protein Transglutaminase, two C-terminal domains [49311] (4 species)
  7. 161421Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (1 PDB entry)
  8. 161429Domain d1kv3d3: 1kv3 D:586-687 [73041]
    Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4

Details for d1kv3d3

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

SCOP Domain Sequences for d1kv3d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv3d3 b.1.5.1 (D:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdlvplhmglhklvvnfesdklkavkgfrnviigpa

SCOP Domain Coordinates for d1kv3d3:

Click to download the PDB-style file with coordinates for d1kv3d3.
(The format of our PDB-style files is described here.)

Timeline for d1kv3d3: