SCOPe 2.06: Domain d1kv3d2: 1kv3 D:469-585

Lineage for d1kv3d2 (1kv3 D:469-585)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (4 PDB entries)
   GDP-binding protein

8. Domain d1kv3d2: 1kv3 D:469-585 [73040]
   Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4
   complexed with gdp

Details for d1kv3d2

PDB Entry: 1kv3, 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

PDB Compounds: (D:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1kv3d2:

Sequence; same for both SEQRES and ATOM records:

>d1kv3d2 b.1.5.1 (D:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky
llnltlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

Timeline for d1kv3d2:

• d1kv3d2 first appeared in SCOP 1.61
  
• d1kv3d2 appears in SCOPe 2.05
  
• d1kv3d2 appears in SCOPe 2.07
  
• d1kv3d2 appears in the current release, SCOPe 2.08