Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (4 PDB entries) GDP-binding protein |
Domain d1kv3d2: 1kv3 D:469-585 [73040] Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4 complexed with gdp |
PDB Entry: 1kv3 (more details), 2.8 Å
SCOPe Domain Sequences for d1kv3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv3d2 b.1.5.1 (D:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky llnltlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle
Timeline for d1kv3d2: