Lineage for d1kuva_ (1kuv A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731297Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 731298Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 731301Domain d1kuva_: 1kuv A: [73020]
    complexed with ca5, mg; mutant

Details for d1kuva_

PDB Entry: 1kuv (more details), 2 Å

PDB Description: x-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
PDB Compounds: (A:) serotonin n-acetyltransferase

SCOP Domain Sequences for d1kuva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuva_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl

SCOP Domain Coordinates for d1kuva_:

Click to download the PDB-style file with coordinates for d1kuva_.
(The format of our PDB-style files is described here.)

Timeline for d1kuva_: