Lineage for d1kuta_ (1kut A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511931Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 511932Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 511933Family d.143.1.1: SAICAR synthase [56105] (1 protein)
  6. 511934Protein SAICAR synthase [56106] (2 species)
  7. 511939Species Thermotoga maritima [TaxId:243274] [75558] (1 PDB entry)
    TM1243
  8. 511940Domain d1kuta_: 1kut A: [73017]

Details for d1kuta_

PDB Entry: 1kut (more details), 2.2 Å

PDB Description: structural genomics, protein tm1243, (saicar synthetase)

SCOP Domain Sequences for d1kuta_:

Sequence, based on SEQRES records: (download)

>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima}
tkivkvtgdyallefkdditagdglkhdvltgkgsicaettailmkylsekgikthlvey
ipprtlkviplkmfplevvvrlkkagsfvrryggaegedlpvplveffikdderhdpmvc
vdhleilgiatkkqaekmkeaavkitlalkefferanfelwdikyefgldkdgnvvlgde
ispdtfrlrkkgeifdkdvyrrdlgdplkkyrevlelcrslnsq

Sequence, based on observed residues (ATOM records): (download)

>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima}
tkivkvtgdyallefkddltgkgsicaettailmkylsekgikthlveyipprtlkvipl
kmfplevvvrlkkagsfvrryggaegedlpvplveffikdderhdpmvcvdhleilgiat
kkqaekmkeaavkitlalkefferanfelwdikyefgldkdgnvvlgdeispdtfrlrkk
geifdkdvyrrdlgdplkkyrevlelcrslnsq

SCOP Domain Coordinates for d1kuta_:

Click to download the PDB-style file with coordinates for d1kuta_.
(The format of our PDB-style files is described here.)

Timeline for d1kuta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kutb_