Lineage for d1kuka_ (1kuk A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607714Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
    Pfam 01421
  6. 607719Protein Snake venom metalloprotease [55520] (7 species)
  7. 607732Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)
  8. 607735Domain d1kuka_: 1kuk A: [73014]
    complexed with cd

Details for d1kuka_

PDB Entry: 1kuk (more details), 1.45 Å

PDB Description: crystal structure of a taiwan habu venom metalloproteinase complexed with pekw.

SCOP Domain Sequences for d1kuka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuka_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

SCOP Domain Coordinates for d1kuka_:

Click to download the PDB-style file with coordinates for d1kuka_.
(The format of our PDB-style files is described here.)

Timeline for d1kuka_: