![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (2 proteins) Pfam 01421 |
![]() | Protein Snake venom metalloprotease [55520] (7 species) |
![]() | Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries) |
![]() | Domain d1kuka_: 1kuk A: [73014] complexed with cd |
PDB Entry: 1kuk (more details), 1.45 Å
SCOP Domain Sequences for d1kuka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuka_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E} qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc skdyyqtfltndnpqcilnap
Timeline for d1kuka_: