SCOPe 2.05: Domain d1kuj.4: 1kuj H:,G:

Lineage for d1kuj.4 (1kuj H:,G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1kuj.4: 1kuj H:,G: [73013]
   complexed with mma

Details for d1kuj.4

PDB Entry: 1kuj, 2 Å

PDB Description: crystal structure of jacalin complexed with 1-o-methyl-alpha-d-mannose

PDB Compounds: (G:) jacalin alpha chain, (H:) jacalin beta chain

SCOPe Domain Sequences for d1kuj.4:

Sequence; same for both SEQRES and ATOM records:

>g1kuj.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1kuj.4:

• d1kuj.4 first appeared in SCOP 1.61
  
• d1kuj.4 appears in SCOPe 2.04
  
• d1kuj.4 appears in SCOPe 2.06
  
• d1kuj.4 appears in the current release, SCOPe 2.08