SCOP 1.73: Domain d1kuj.4: 1kuj H:,G:

Lineage for d1kuj.4 (1kuj H:,G:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1kuj.4: 1kuj H:,G: [73013]
   complexed with mam

Details for d1kuj.4

PDB Entry: 1kuj, 2 Å

PDB Description: crystal structure of jacalin complexed with 1-o-methyl-alpha-d-mannose

PDB Compounds: (G:) jacalin alpha chain, (H:) jacalin beta chain

SCOP Domain Sequences for d1kuj.4:

Sequence; same for both SEQRES and ATOM records:

>g1kuj.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1kuj.4:

• d1kuj.4 first appeared in SCOP 1.61
  
• d1kuj.4 appears in SCOP 1.71
  
• d1kuj.4 appears in SCOP 1.75
  
• d1kuj.4 appears in the current release, SCOPe 2.08