SCOP 1.71: Domain d1kuj.1: 1kuj B:,A:

Lineage for d1kuj.1 (1kuj B:,A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus integrifolia) [51104] (10 PDB entries)

8. Domain d1kuj.1: 1kuj B:,A: [73010]

Details for d1kuj.1

PDB Entry: 1kuj, 2 Å

PDB Description: crystal structure of jacalin complexed with 1-o-methyl-alpha-d-mannose

SCOP Domain Sequences for d1kuj.1:

Sequence; same for both SEQRES and ATOM records:

>g1kuj.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus integrifolia)}
eqsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgq
nhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgt
pfnlpienglivgfkgsigywldyfsmylsl

Timeline for d1kuj.1:

• d1kuj.1 first appeared in SCOP 1.61
  
• d1kuj.1 appears in SCOP 1.69
  
• d1kuj.1 appears in SCOP 1.73
  
• d1kuj.1 appears in the current release, SCOPe 2.08