Lineage for d1kufa_ (1kuf A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 332013Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 332014Protein Snake venom metalloprotease [55520] (5 species)
  7. 332025Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)
  8. 332026Domain d1kufa_: 1kuf A: [73007]
    complexed with cd

Details for d1kufa_

PDB Entry: 1kuf (more details), 1.35 Å

PDB Description: High-resolution Crystal Structure of a Snake Venom Metalloproteinase from Taiwan Habu

SCOP Domain Sequences for d1kufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

SCOP Domain Coordinates for d1kufa_:

Click to download the PDB-style file with coordinates for d1kufa_.
(The format of our PDB-style files is described here.)

Timeline for d1kufa_: