SCOPe 2.04: Domain d1ku7d_: 1ku7 D:

Lineage for d1ku7d_ (1ku7 D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.2: Sigma4 domain [88665] (5 proteins)

6. Protein Sigma70 (SigA, RpoD) [88666] (4 species)

7. Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries)

8. Domain d1ku7d_: 1ku7 D: [73002]
   sigma4 domain only
   protein/DNA complex; protein/RNA complex

Details for d1ku7d_

PDB Entry: 1ku7, 2.4 Å

PDB Description: crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna

PDB Compounds: (D:) sigma factor sigA

SCOPe Domain Sequences for d1ku7d_:

Sequence; same for both SEQRES and ATOM records:

>d1ku7d_ a.4.13.2 (D:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]}
kalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklkyhesrt
rklrdfle

Timeline for d1ku7d_:

• d1ku7d_ first appeared in SCOP 1.61
  
• d1ku7d_ appears in SCOPe 2.03
  
• d1ku7d_ appears in SCOPe 2.05
  
• d1ku7d_ appears in the current release, SCOPe 2.08