Lineage for d1ku3a_ (1ku3 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763476Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 763509Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 763517Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 763523Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries)
  8. 763524Domain d1ku3a_: 1ku3 A: [73000]
    sigma4 domain only
    mutant

Details for d1ku3a_

PDB Entry: 1ku3 (more details), 1.8 Å

PDB Description: crystal structure of thermus aquaticus rna polymerase sigma subunit fragment, region 4
PDB Compounds: (A:) sigma factor sigA

SCOP Domain Sequences for d1ku3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]}
elekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklkyhe
s

SCOP Domain Coordinates for d1ku3a_:

Click to download the PDB-style file with coordinates for d1ku3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku3a_: