Lineage for d1ku1b1 (1ku1 B:558-746)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339314Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2339315Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2339319Protein ARF guanine-exchange factor 2, Gea2 [74776] (1 species)
  7. 2339320Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74777] (1 PDB entry)
  8. 2339322Domain d1ku1b1: 1ku1 B:558-746 [72997]
    Other proteins in same PDB: d1ku1a2, d1ku1a3, d1ku1b2, d1ku1b3

Details for d1ku1b1

PDB Entry: 1ku1 (more details), 1.93 Å

PDB Description: crystal structure of the sec7 domain of yeast gea2
PDB Compounds: (B:) ARF guanine-nucleotide exchange factor 2

SCOPe Domain Sequences for d1ku1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku1b1 a.118.3.1 (B:558-746) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnkktiglllch
pdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssaycenqdydp
skisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysgnlkgccnhk
dfpfwyldr

SCOPe Domain Coordinates for d1ku1b1:

Click to download the PDB-style file with coordinates for d1ku1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ku1b1: