Lineage for d1ku1b_ (1ku1 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1095987Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1095988Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 1095992Protein ARF guanine-exchange factor 2, Gea2 [74776] (1 species)
  7. 1095993Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74777] (1 PDB entry)
  8. 1095995Domain d1ku1b_: 1ku1 B: [72997]

Details for d1ku1b_

PDB Entry: 1ku1 (more details), 1.93 Å

PDB Description: crystal structure of the sec7 domain of yeast gea2
PDB Compounds: (B:) ARF guanine-nucleotide exchange factor 2

SCOPe Domain Sequences for d1ku1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku1b_ a.118.3.1 (B:) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
nlkgccnhkdfpfwyldrvycsirdkeivmp

SCOPe Domain Coordinates for d1ku1b_:

Click to download the PDB-style file with coordinates for d1ku1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ku1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ku1a_