Lineage for d1ku1b_ (1ku1 B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies) 
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (3 proteins) 
Protein ARF guanine-exchange factor 2, Gea2 [74776] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74777] (1 PDB entry) 
Domain d1ku1b_: 1ku1 B: [72997]
Details for d1ku1b_
PDB Entry: 1ku1 (more details), 1.93 Å
PDB Description: crystal structure of the sec7 domain of yeast gea2
SCOP Domain Sequences for d1ku1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku1b_ a.118.3.1 (B:) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae)}
glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
nlkgccnhkdfpfwyldrvycsirdkeivmp
SCOP Domain Coordinates for d1ku1b_:
Click to download the PDB-style file with coordinates for d1ku1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ku1b_:
- d1ku1b_ is new in SCOP 1.61
- d1ku1b_ appears in SCOP 1.63
- d1ku1b_ appears in the current release, SCOPe 2.08, called d1ku1b1
View in 3D
