SCOPe 2.06: Domain d1ku1a1: 1ku1 A:558-746

Lineage for d1ku1a1 (1ku1 A:558-746)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.1: Sec7 domain [48426] (6 proteins)
   Pfam PF01369

6. Protein ARF guanine-exchange factor 2, Gea2 [74776] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74777] (1 PDB entry)

8. Domain d1ku1a1: 1ku1 A:558-746 [72996]
   Other proteins in same PDB: d1ku1a2, d1ku1a3, d1ku1b2, d1ku1b3

Details for d1ku1a1

PDB Entry: 1ku1, 1.93 Å

PDB Description: crystal structure of the sec7 domain of yeast gea2

PDB Compounds: (A:) ARF guanine-nucleotide exchange factor 2

SCOPe Domain Sequences for d1ku1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ku1a1 a.118.3.1 (A:558-746) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnkktiglllch
pdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssaycenqdydp
skisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysgnlkgccnhk
dfpfwyldr

Timeline for d1ku1a1:

• d1ku1a1 first appeared in SCOP 1.61, called d1ku1a_
  
• d1ku1a1 was called d1ku1a_ in SCOPe 2.05
  
• d1ku1a1 appears in SCOPe 2.07
  
• d1ku1a1 appears in the current release, SCOPe 2.08