Lineage for d1ku1a_ (1ku1 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217150Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 217151Family a.118.3.1: Sec7 domain [48426] (3 proteins)
  6. 217152Protein ARF guanine-exchange factor 2, Gea2 [74776] (1 species)
  7. 217153Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74777] (1 PDB entry)
  8. 217154Domain d1ku1a_: 1ku1 A: [72996]

Details for d1ku1a_

PDB Entry: 1ku1 (more details), 1.93 Å

PDB Description: crystal structure of the sec7 domain of yeast gea2

SCOP Domain Sequences for d1ku1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku1a_ a.118.3.1 (A:) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae)}
glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
nlkgccnhkdfpfwyldrvycsirdkeivmp

SCOP Domain Coordinates for d1ku1a_:

Click to download the PDB-style file with coordinates for d1ku1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ku1b_