Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
Protein Lipase L1 [75288] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75289] (1 PDB entry) |
Domain d1ku0b_: 1ku0 B: [72995] complexed with ca, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ku0 (more details), 2 Å
SCOPe Domain Sequences for d1ku0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku0b_ c.69.1.18 (B:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} randapivllhgftgwgreemlgfkywggvrgdieqwlndngyrtytlavgplssnwdra ceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrvhiiahsqggqtarmlv sllengsqeereyakehnvslsplfegghrfvlsvttiatphdgttlvnmvdftdrffdl qkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdtaryd lsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapflgsyr naalgidshwlgndgivntismngpkrgsndrivpydgtlkkgvwndmgtynvdhlevig vdpnpsfnirafylrlaeqlaslrp
Timeline for d1ku0b_: