SCOPe 2.08: Domain d1ku0b_: 1ku0 B:

Lineage for d1ku0b_ (1ku0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase L1 [75288] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75289] (1 PDB entry)

8. Domain d1ku0b_: 1ku0 B: [72995]
   complexed with ca, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1ku0b_

PDB Entry: 1ku0, 2 Å

PDB Description: structure of the bacillus stearothermophilus l1 lipase

PDB Compounds: (B:) L1 lipase

SCOPe Domain Sequences for d1ku0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ku0b_ c.69.1.18 (B:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]}
randapivllhgftgwgreemlgfkywggvrgdieqwlndngyrtytlavgplssnwdra
ceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrvhiiahsqggqtarmlv
sllengsqeereyakehnvslsplfegghrfvlsvttiatphdgttlvnmvdftdrffdl
qkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdtaryd
lsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapflgsyr
naalgidshwlgndgivntismngpkrgsndrivpydgtlkkgvwndmgtynvdhlevig
vdpnpsfnirafylrlaeqlaslrp

Timeline for d1ku0b_:

• d1ku0b_ first appeared in SCOP 1.61
  
• d1ku0b_ appears in SCOPe 2.07