Lineage for d1ktrl_ (1ktr L:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species scFv 3d5, (mouse), kappa L chain [74818] (1 PDB entry) 
Domain d1ktrl_: 1ktr L: [72993]
Details for d1ktrl_
PDB Entry: 1ktr (more details), 2.7 Å
PDB Description: crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
SCOP Domain Sequences for d1ktrl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktrl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {scFv 3d5, (mouse), kappa L chain}
dilmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr
SCOP Domain Coordinates for d1ktrl_:
Click to download the PDB-style file with coordinates for d1ktrl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ktrl_:
- d1ktrl_ is new in SCOP 1.61
- d1ktrl_ appears in SCOP 1.63
- d1ktrl_ appears in the current release, SCOPe 2.08
View in 3D
