Lineage for d1ktrh_ (1ktr H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756146Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1756257Domain d1ktrh_: 1ktr H: [72992]
    Other proteins in same PDB: d1ktrl_
    part of scFv 3d5

Details for d1ktrh_

PDB Entry: 1ktr (more details), 2.7 Å

PDB Description: crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
PDB Compounds: (H:) Anti-his tag antibody 3d5 variable heavy chain

SCOPe Domain Sequences for d1ktrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktrh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgpedvkpgasvkisckasgytftdyymnwvkqspgkglewigdinpnnggtsy
nqkfkgratltvdkssstaymelrsltsedssvyycesqsgaywgqgttvtvsa

SCOPe Domain Coordinates for d1ktrh_:

Click to download the PDB-style file with coordinates for d1ktrh_.
(The format of our PDB-style files is described here.)

Timeline for d1ktrh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktrl_