| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein Phycocyanin beta subunit [88940] (8 species) |
| Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries) |
| Domain d1ktpb_: 1ktp B: [72991] Other proteins in same PDB: d1ktpa_ complexed with bla, cyc |
PDB Entry: 1ktp (more details), 1.6 Å
SCOPe Domain Sequences for d1ktpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktpb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d1ktpb_: