SCOPe 2.05: Domain d1ktpa_: 1ktp A:

Lineage for d1ktpa_ (1ktp A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)

8. Domain d1ktpa_: 1ktp A: [72990]
   Other proteins in same PDB: d1ktpb_
   complexed with bla, cyc

Details for d1ktpa_

PDB Entry: 1ktp, 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms

PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d1ktpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ktpa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1ktpa_:

• d1ktpa_ first appeared in SCOP 1.61
  
• d1ktpa_ appears in SCOPe 2.04
  
• d1ktpa_ appears in SCOPe 2.06
  
• d1ktpa_ appears in the current release, SCOPe 2.08