SCOP 1.61: Domain d1ktpa_: 1ktp A:

Lineage for d1ktpa_ (1ktp A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)

6. Protein Phycocyanin [46533] (5 species)

7. Species Synechococcus vulcanus [TaxId:32053] [63443] (2 PDB entries)

8. Domain d1ktpa_: 1ktp A: [72990]

Details for d1ktpa_

PDB Entry: 1ktp, 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms

SCOP Domain Sequences for d1ktpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ktpa_ a.1.1.3 (A:) Phycocyanin {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1ktpa_:

• d1ktpa_ is new in SCOP 1.61
  
• d1ktpa_ appears in SCOP 1.63
  
• d1ktpa_ appears in the current release, SCOPe 2.08