Lineage for d1ktpa_ (1ktp A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 149061Family a.1.1.3: Phycocyanin-like [46532] (4 protein domains)
  6. 149079Protein Phycocyanin [46533] (5 species)
  7. 149144Species Synechococcus vulcanus [TaxId:32053] [63443] (2 PDB entries)
  8. 149145Domain d1ktpa_: 1ktp A: [72990]

Details for d1ktpa_

PDB Entry: 1ktp (more details), 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms

SCOP Domain Sequences for d1ktpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktpa_ a.1.1.3 (A:) Phycocyanin {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOP Domain Coordinates for d1ktpa_:

Click to download the PDB-style file with coordinates for d1ktpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ktpa_: