Lineage for d1ktkf1 (1ktk F:4-116)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 protein domains)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158725Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (8 PDB entries)
  8. 158733Domain d1ktkf1: 1ktk F:4-116 [72986]
    Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke2, d1ktkf2

Details for d1ktkf1

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkf1:

Sequence, based on SEQRES records: (download)

>d1ktkf1 b.1.1.1 (F:4-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
vsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeqgve
kdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltv

Sequence, based on observed residues (ATOM records): (download)

>d1ktkf1 b.1.1.1 (F:4-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
vsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatgvekkf
linhasltlstltvtsahpedssfyicyfgpgtrltv

SCOP Domain Coordinates for d1ktkf1:

Click to download the PDB-style file with coordinates for d1ktkf1.
(The format of our PDB-style files is described here.)

Timeline for d1ktkf1: