Lineage for d1ktkd2 (1ktk D:96-208)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189555Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 189556Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 189643Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 189644Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 189650Domain d1ktkd2: 1ktk D:96-208 [72983]
    Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkd2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkd2:

Sequence, based on SEQRES records: (download)

>d1ktkd2 d.15.6.1 (D:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Sequence, based on observed residues (ATOM records): (download)

>d1ktkd2 d.15.6.1 (D:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqlnnkiilekdivtfqeidfkirkylnykiypyvsgrieigtk
dgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOP Domain Coordinates for d1ktkd2:

Click to download the PDB-style file with coordinates for d1ktkd2.
(The format of our PDB-style files is described here.)

Timeline for d1ktkd2: