Lineage for d1ktkb2 (1ktk B:96-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934520Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 2934521Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 2934525Domain d1ktkb2: 1ktk B:96-207 [72979]
    Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkb2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)
PDB Compounds: (B:) Exotoxin type C

SCOPe Domain Sequences for d1ktkb2:

Sequence, based on SEQRES records: (download)

>d1ktkb2 d.15.6.1 (B:96-207) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiyle

Sequence, based on observed residues (ATOM records): (download)

>d1ktkb2 d.15.6.1 (B:96-207) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfiqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvsgriei
gtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiyle

SCOPe Domain Coordinates for d1ktkb2:

Click to download the PDB-style file with coordinates for d1ktkb2.
(The format of our PDB-style files is described here.)

Timeline for d1ktkb2: