Lineage for d1ktkb1 (1ktk B:3-95)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297298Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 297299Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)
  8. 297303Domain d1ktkb1: 1ktk B:3-95 [72978]
    Other proteins in same PDB: d1ktka2, d1ktkb2, d1ktkc2, d1ktkd2, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkb1

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktkb1 b.40.2.2 (B:3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1ktkb1:

Click to download the PDB-style file with coordinates for d1ktkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ktkb1: