SCOPe 2.05: Domain d1ktjb_: 1ktj B:

Lineage for d1ktjb_ (1ktj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (2 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries)

8. Domain d1ktjb_: 1ktj B: [72975]

Details for d1ktjb_

PDB Entry: 1ktj, 2.15 Å

PDB Description: x-ray structure of der p 2, the major house dust mite allergen

PDB Compounds: (B:) allergen der p 2

SCOPe Domain Sequences for d1ktjb_:

Sequence; same for both SEQRES and ATOM records:

>d1ktjb_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId: 6956]}
sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird

Timeline for d1ktjb_:

• d1ktjb_ first appeared in SCOP 1.61
  
• d1ktjb_ appears in SCOPe 2.04
  
• d1ktjb_ appears in SCOPe 2.06
  
• d1ktjb_ appears in the current release, SCOPe 2.08