Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.7: ML domain [81287] (2 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products |
Protein Major mite allergen [49256] (2 species) contains additional N-terminal strand |
Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries) |
Domain d1ktjb_: 1ktj B: [72975] mutant |
PDB Entry: 1ktj (more details), 2.15 Å
SCOP Domain Sequences for d1ktjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktjb_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2} sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca iathakird
Timeline for d1ktjb_: