![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.7: ML domain [81287] (3 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products automatically mapped to Pfam PF02221 |
![]() | Protein Major mite allergen [49256] (2 species) contains additional N-terminal strand |
![]() | Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries) |
![]() | Domain d1ktja_: 1ktj A: [72974] |
PDB Entry: 1ktj (more details), 2.15 Å
SCOPe Domain Sequences for d1ktja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktja_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId: 6956]} sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca iathakird
Timeline for d1ktja_: