Lineage for d1ktja_ (1ktj A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Major mite allergen [49256] (2 species) Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries) 
Domain d1ktja_: 1ktj A: [72974]
Details for d1ktja_
PDB Entry: 1ktj (more details), 2.15 Å
PDB Description: x-ray structure of der p 2, the major house dust mite allergen
SCOP Domain Sequences for d1ktja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktja_ b.1.1.5 (A:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2}
sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird
SCOP Domain Coordinates for d1ktja_:
Click to download the PDB-style file with coordinates for d1ktja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ktja_:
- d1ktja_ is new in SCOP 1.61
- d1ktja_ appears in SCOP 1.63
- d1ktja_ appears in the current release, SCOPe 2.08
View in 3D
