Lineage for d1ktja_ (1ktj A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160779Protein Major mite allergen [49256] (2 species)
  7. 160783Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries)
  8. 160784Domain d1ktja_: 1ktj A: [72974]

Details for d1ktja_

PDB Entry: 1ktj (more details), 2.15 Å

PDB Description: x-ray structure of der p 2, the major house dust mite allergen

SCOP Domain Sequences for d1ktja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktja_ b.1.1.5 (A:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2}
sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird

SCOP Domain Coordinates for d1ktja_:

Click to download the PDB-style file with coordinates for d1ktja_.
(The format of our PDB-style files is described here.)

Timeline for d1ktja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktjb_