Lineage for d1ktdd1 (1ktd D:121-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358779Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2358881Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2358901Domain d1ktdd1: 1ktd D:121-215 [72970]
    Other proteins in same PDB: d1ktda1, d1ktda2, d1ktdb2, d1ktdc1, d1ktdc2, d1ktdd2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, so4

Details for d1ktdd1

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide
PDB Compounds: (D:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1ktdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktdd1 b.1.1.2 (D:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOPe Domain Coordinates for d1ktdd1:

Click to download the PDB-style file with coordinates for d1ktdd1.
(The format of our PDB-style files is described here.)

Timeline for d1ktdd1: