SCOP 1.63: Domain d1ktdc2: 1ktd C:1-81

Lineage for d1ktdc2 (1ktd C:1-81)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)

8. Domain d1ktdc2: 1ktd C:1-81 [72969]
   Other proteins in same PDB: d1ktda1, d1ktdb1, d1ktdc1, d1ktdd1

Details for d1ktdc2

PDB Entry: 1ktd, 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

SCOP Domain Sequences for d1ktdc2:

Sequence; same for both SEQRES and ATOM records:

>d1ktdc2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

Timeline for d1ktdc2:

• d1ktdc2 first appeared in SCOP 1.61
  
• d1ktdc2 appears in SCOP 1.65
  
• d1ktdc2 appears in the current release, SCOPe 2.08