Lineage for d1ktdc1 (1ktd C:82-182)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548801Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 548867Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 548879Domain d1ktdc1: 1ktd C:82-182 [72968]
    Other proteins in same PDB: d1ktda2, d1ktdb1, d1ktdb2, d1ktdc2, d1ktdd1, d1ktdd2
    complexed with nag, so4; mutant

Details for d1ktdc1

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

SCOP Domain Sequences for d1ktdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktdc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOP Domain Coordinates for d1ktdc1:

Click to download the PDB-style file with coordinates for d1ktdc1.
(The format of our PDB-style files is described here.)

Timeline for d1ktdc1: